Image 1 of 5Research vials only. Discounts and Bundle & Save don't apply to Reconstitution Solution; Subscribe & Save 5% does.
Full terms
Original laboratory certificate
1301.OPT.260914-R1optiqhealthlabs.comTesamorelin is a synthetic analogue of human growth hormone-releasing hormone, GHRH(1-44), with a trans-3-hexenoyl group at the N-terminus and a C-terminal amide. It is a 44-amino-acid peptide. Supplied for in-vitro research use only.
Made in the USA
Storage Instructions
Storage: Store the sealed vial at −20 °C, protected from light and moisture. Move it to −20 °C on arrival. Shipping: Compounds are stable at ambient temperature for the days to weeks of normal transit, so cold-chain shipping isn't needed. Before opening: Let the sealed vial reach room temperature before opening to prevent condensation.
| Product Name | Tesamorelin |
|---|---|
| Format | Lyophilized powder |
| Sequence | (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Molecular Formula | C221H366N72O67S |
| Molecular Weight | 5,135.86 g/mol |
| CAS Number | 218949-48-5 |
| PubChem | CID 16137828 |
| Origin | Made in the USA |
| Intended Use | In-vitro research only; not for human or animal consumption. |
No references on file for this compound.
AKRO Research products are for in-vitro research use only — not for human or animal use.
